DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18048 and Trmt13

Sequence 1:NP_649646.3 Gene:CG18048 FlyBaseID:FBgn0037435 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001029074.2 Gene:Trmt13 RGDID:1565211 Length:495 Species:Rattus norvegicus

Alignment Length:487 Identity:156/488 (32%)
Similarity:254/488 (52%) Gaps:88/488 (18%)


  Fly    14 EKPVTTT----------CSYWVLRKKRRCKMTANKGSEFCGAHASSAATTATCDEKAREDSFQER 68
            |.|..||          |:|:|.:|||.|:|....|..|||.||.|          |.|::.::|
  Rat     2 EAPAPTTPAIGFPTDGRCNYFVEKKKRFCRMVVAAGKRFCGEHAGS----------AEEENARKR 56

  Fly    69 IPCPLDHKHTVFKRKLAKHLTICNARDQESSLPYIVKGVNSGDNLKETDEDLNKFNQIKLHELAD 133
            |.||||.||||::.:|||||..||:|::... .:.::.:|:|  ||:..|.|.:.  :.|..|::
  Rat    57 ILCPLDPKHTVYEDQLAKHLKKCNSREKPKP-DFFIQDINAG--LKDETEILEQL--VPLSSLSE 116

  Fly   134 EEFYSLIDKVKNLYDKHINSSIQELQLEHESLKEELSRKDYGQETLRQLTQTTSLLGILEHDHQL 198
            |:..:||.|::.. .:.:||:.::..:.|.:|.:.|:....|...::.|.|..|:||.:|....|
  Rat   117 EQLETLIKKLRKA-SEGLNSTHEDHIMSHPALHDALNDPRNGDCAVKHLKQQASILGNIEKLKLL 180

  Fly   199 MDHTSYIEFGAGKGQLAYFLATVLQEQKLSHSQVVLIDRMSLRHKKDNKLANR-EVVQRIRADIA 262
            .....::|||||||:|::::...|::.:..|  .:|:::::.|.|.|.|...: .|.:|::.||.
  Rat   181 GPRRCFVEFGAGKGKLSHWVDIALKDAENVH--FILVEKVTTRFKVDGKHRKKNSVFERLQIDIQ 243

  Fly   263 DLKLSALPELKKTQ-RTVAFSKHLCGAATDLTLRCI----------------------------- 297
            .|.|:.||.|::.: ..|...|||||.||||.|||:                             
  Rat   244 HLCLNRLPVLREGRLPVVGIGKHLCGVATDLALRCLVETYAASFKEKDEEPLAKRVKNDKTEKES 308

  Fly   298 --LGDGNASSDY---------VLIALCCHHRCSWRSYVGRKFLQEAGIGPREFVILTKMVSWAVC 351
              |....:..|.         ::|||||||||.||.|||:::.:..|:|..||....:|.|||.|
  Rat   309 NTLAKEGSEKDVPETRTPVAGIVIALCCHHRCDWRHYVGKEYFKALGLGAVEFYYFQRMSSWATC 373

  Fly   352 G-------TGLSRERRKAMESADFQ-------LTETNTQ----RLTRQEREQIGQQCKRVLDYGR 398
            |       :.::.||:.|.:..:.:       ||:.:|.    .||.:|:::||..||.::|.||
  Rat   374 GMRTSLEASDVTAERKDAQKDEEEEHDDVGDRLTDGSTDSLPGTLTVEEKKKIGHLCKLLIDQGR 438

  Fly   399 LEHLRSHGYQAELKFYVPRDVTLENVVLLARP 430
            |::|:..|:...|::|....|:||||:|.|.|
  Rat   439 LQYLQQKGFSPALQYYTDPLVSLENVLLTAVP 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18048NP_649646.3 zf-TRM13_CCCH 20..44 CDD:288558 12/34 (35%)
zf-U11-48K 69..92 CDD:283028 15/23 (65%)
TRM13 183..429 CDD:282990 97/306 (32%)
Trmt13NP_001029074.2 zf-TRM13_CCCH 17..45 CDD:288558 13/28 (46%)
zf-U11-48K 59..80 CDD:283028 14/21 (67%)
TRM13 165..469 CDD:282990 97/306 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255214729
eggNOG 1 0.900 E1_KOG2811
Hieranoid 1 1.000
Homologene 1 1.000 H6875
Inparanoid 1 1.050 240 1.000 Inparanoid score I3209
OMA 1 1.010
OrthoDB 1 1.010 D364329at33208
OrthoFinder 1 1.000 FOG0003971
OrthoInspector 1 1.000 T1086976
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12998
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.