DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18048 and Y49A3A.3

Sequence 1:NP_649646.3 Gene:CG18048 FlyBaseID:FBgn0037435 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_506560.1 Gene:Y49A3A.3 WormBaseID:WBGene00013026 Length:390 Species:Caenorhabditis elegans

Alignment Length:435 Identity:128/436 (29%)
Similarity:212/436 (49%) Gaps:63/436 (14%)


  Fly     8 MTTVKAEKPVTTTCSYWVLRKKRRCKMTANKGSEFCGAHASSAATTATCDEKAREDSFQERIPCP 72
            :.:||.::.....|.|.:..|||||||...||:.|||.|:            ..:.:..:|:.||
 Worm     3 LDSVKQQQQQNACCEYILPIKKRRCKMLVKKGNRFCGEHS------------IHDQNNTDRMVCP 55

  Fly    73 LDHKHTVFKRKLAKHLTICNARDQESSLPYIVKGVNS--GDNLKETDEDLNKFNQIKLHELA-DE 134
            .|.|||:.|..|..|||.||:|.:::.  ||....||  |:. |.||         |:...| ::
 Worm    56 NDGKHTILKADLEIHLTRCNSRIRDAE--YIKIDANSIRGET-KRTD---------KIDRRATED 108

  Fly   135 EFYSLIDKVKNLYDKHINSSIQELQLEHESLKEELSR-KDYGQETLRQLTQTTSLLGILEHDHQL 198
            |..:.:.|:...|:..:...:...|..:|.:::.::: .|......:||.|.:|:||.:|....|
 Worm   109 EICTTVHKIWKCYETDVMDRLIVEQQRNELVEQNIAQNSDLNNTKKKQLYQISSILGHIESTGLL 173

  Fly   199 --MDHTSYIEFGAGKGQLAYFLATVLQEQKLSHSQVVLIDRMSLRHKKDNKLANRE----VVQRI 257
              ...:...|.|||||||||:::     :...:...:|:||...|:|.|. .|.||    .::|.
 Worm   174 PTCSKSCMFELGAGKGQLAYWIS-----KAAPNGNYILMDRSGSRNKFDT-AAFRENPNLSMKRF 232

  Fly   258 RADIADLKLSALPELKKTQRTVAFSKHLCGAATDLTLRCILGDG---NASSDYVLIALCCHHRCS 319
            |..|..:.||.:.|||.:::.:|..||.||:|||..:|.::..|   ||:    |:..||||:..
 Worm   233 RCSIEHMDLSKIDELKNSEKILAICKHFCGSATDAGIRSLMNSGLQFNAA----LLIPCCHHKSR 293

  Fly   320 WRSYVGRKFLQEAGIGPR-EFVILTKMVSWAVCGTGLSRERRKAMESADFQLTETNTQRLTRQER 383
            :..|.|..||::..:... .|..|..:.|:|..| .:..|..:..:|....|             
 Worm   294 FAEYGGHDFLEKWEMNDEASFAALRYIASFATNG-AVDTEATEGWKSIHPPL------------- 344

  Fly   384 EQIGQQCKRVLDYGRLEHLRSHGYQAELKFYVPRDVTLENVVLLA 428
             ::|::.|.:|:.||...|.|.|::..:..|||.:|:.||:::||
 Worm   345 -ELGRRAKAILEIGRAIWLESVGFKTRVVEYVPPEVSPENLLILA 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18048NP_649646.3 zf-TRM13_CCCH 20..44 CDD:288558 13/24 (54%)
zf-U11-48K 69..92 CDD:283028 12/23 (52%)
TRM13 183..429 CDD:282990 78/257 (30%)
Y49A3A.3NP_506560.1 zf-TRM13_CCCH 16..41 CDD:288558 14/25 (56%)
zf-U11-48K 52..75 CDD:283028 12/23 (52%)
AdoMet_MTases 159..388 CDD:302624 77/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C254592664
eggNOG 1 0.900 E1_KOG2811
Hieranoid 1 1.000
Homologene 1 1.000 H6875
Inparanoid 1 1.050 163 1.000 Inparanoid score I2793
Isobase 1 0.950 0 Normalized mean entropy S2977
OMA 1 1.010
OrthoDB 1 1.010 D364329at33208
OrthoFinder 1 1.000 FOG0003971
OrthoInspector 1 1.000 T474701
orthoMCL 1 0.900 OOG5_129749
Panther 1 1.100 LDO PTHR12998
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1546
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.