DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18048 and trm13

Sequence 1:NP_649646.3 Gene:CG18048 FlyBaseID:FBgn0037435 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_593914.2 Gene:trm13 PomBaseID:SPAC1805.03c Length:368 Species:Schizosaccharomyces pombe

Alignment Length:382 Identity:134/383 (35%)
Similarity:204/383 (53%) Gaps:52/383 (14%)


  Fly    67 ERIPCPLDHKHTVFKRKLAKHLTICNARDQESSLPYIVKGVNSGDNLKETDEDLNKFNQIKLHEL 131
            ::||||.|||||:.:.:|..||..||||..|.:.||..|.:|.     .|..|.::.:..::.:|
pombe    14 KQIPCPYDHKHTIVRHRLEYHLKRCNARPVERTDPYYKKDINI-----STSTDASESSSFEIVDL 73

  Fly   132 ADEEFYSLIDKVKNLYDKHINSSI---QELQLEHESLK---EELSRKDYGQETLRQLTQTTSLLG 190
            :.||    :.|...|::: |:.|:   |:..|.|.::.   ||.::|       :...|..||||
pombe    74 SKEE----LSKWICLFNR-ISDSLPTPQKKVLFHPAMNARLEEGTKK-------KHAIQQASLLG 126

  Fly   191 ILEHDHQLMDHTS-YIEFGAGKGQLAYFLATVLQEQKLSHSQVVLIDRMSLRHKKDNKLANREV- 253
            .:|..|...:..| |.|||||:.:|:.::....|::.:    .:||||.|.|.|.|:::....: 
pombe   127 HMEKLHYFDNQGSIYYEFGAGRAELSRYVQHCSQQENV----YILIDRDSNRTKHDSRILKDSIK 187

  Fly   254 -------VQRIRADIADLKLSAL-PELKKTQRTV-AFSKHLCGAATDLTLRCILGDGNASSDYVL 309
                   :.|.:.||.||||... .|.:.:.:.| |:|||||||||||||.|:   .::..:.::
pombe   188 NNWPEPKIIRCKIDIKDLKLDFFASEFRNSGKPVFAYSKHLCGAATDLTLNCL---KSSPPNALV 249

  Fly   310 IALCCHHRCSWR--SYVGRKFLQEAGI-GPREFVILTKMVSWAVCGTGLSRERRKAMESADFQLT 371
            |||||||.|.||  |...|:.|...|| .|:||.||.:|..|||   ...||...|...||    
pombe   250 IALCCHHHCRWRTLSTFAREQLSHWGISNPQEFQILRQMTGWAV---NSLREHMHASGGAD---- 307

  Fly   372 ETNTQRLTRQEREQIGQQCKRVLDYGRLEHLRSHGYQAELKFYVPRDVTLENVVLLA 428
             ::...|:.:||.:||.:||.:::|.|.......||::.|.:||..:.|||||.|:|
pombe   308 -SHISGLSHEERVKIGLKCKHIINYMRKLECEKMGYESSLVYYVGEETTLENVALIA 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18048NP_649646.3 zf-TRM13_CCCH 20..44 CDD:288558
zf-U11-48K 69..92 CDD:283028 13/23 (57%)
TRM13 183..429 CDD:282990 98/261 (38%)
trm13NP_593914.2 zf-U11-48K 16..39 CDD:283028 13/23 (57%)
TRM13 119..364 CDD:282990 98/261 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6875
Inparanoid 1 1.050 185 1.000 Inparanoid score I1073
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003971
OrthoInspector 1 1.000 T1124870
orthoMCL 1 0.900 OOG5_129749
Panther 1 1.100 LDO PTHR12998
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1546
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.