DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18048 and Trmt13

Sequence 1:NP_649646.3 Gene:CG18048 FlyBaseID:FBgn0037435 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_084292.1 Gene:Trmt13 MGIID:1925219 Length:481 Species:Mus musculus

Alignment Length:481 Identity:156/482 (32%)
Similarity:254/482 (53%) Gaps:84/482 (17%)


  Fly    16 PVTTTCSYWVLRKKRRCKMTANKGSEFCGAHASSAATTATCDEKAREDSFQERIPCPLDHKHTVF 80
            |:...|:|:|.:|||.|:|.|..|..|||.||.|          |.|::.::||.||||.||||:
Mouse    14 PIDGRCNYFVEKKKRFCRMVAAAGKRFCGEHAGS----------AEEENTRKRILCPLDPKHTVY 68

  Fly    81 KRKLAKHLTICNARDQESSLPYIVKGVNSGDNLK---ETDEDLNKFNQIKLHELADEEFYSLIDK 142
            :.:|||||..||:|::... .:.::.:|:|  ||   |..|.|..|:     .|::|:..:||.|
Mouse    69 EDQLAKHLKKCNSREKPKP-DFFIQDINAG--LKDETEIPEQLVPFS-----SLSEEQLENLIKK 125

  Fly   143 VKNLYDKHINSSIQELQLEHESLKEELSRKDYGQETLRQLTQTTSLLGILEHDHQLMDHTSYIEF 207
            ::.. .:.:||:.::..:.|.:|.:.|:....|...::.|.|..|:||.:|....|.....::||
Mouse   126 LRKA-SEGLNSTHEDHIMSHPALHDALNDPRNGDCAVKHLKQQASILGNIEKLKLLGPRRCFVEF 189

  Fly   208 GAGKGQLAYFLATVLQEQKLSHSQVVLIDRMSLRHKKDNKLANRE-VVQRIRADIADLKLSALPE 271
            |||||:|::::...|::.:..|  .:|::|::.|.|.|.|...:: |.:|::.||..|.|:.:|.
Mouse   190 GAGKGKLSHWVDIALKDAENVH--FILVERVTTRFKVDGKHRKKDSVFERLQIDIQHLCLNRVPV 252

  Fly   272 LKKTQ-RTVAFSKHLCGAATDLTLRCILGDGNASSDY---------------------------- 307
            |::.: ..|...|||||.|||:.|||::....||.:.                            
Mouse   253 LREGRLPVVGIGKHLCGVATDVALRCLVETYAASFEEKDEEPLAKRIKNDKTEKESNTLAKEGSE 317

  Fly   308 ------------VLIALCCHHRCSWRSYVGRKFLQEAGIGPREFVILTKMVSWAVC-------GT 353
                        ::|||||||||.||.|||:::.:..|:|..||....:|.|||.|       |:
Mouse   318 KDVPETWTPVAGIVIALCCHHRCDWRHYVGKEYFKALGLGAVEFYYFQRMSSWATCGMRTSLEGS 382

  Fly   354 GLSRERRKAM-------ESADFQLTETNTQR----LTRQEREQIGQQCKRVLDYGRLEHLRSHGY 407
            .::.||:.|.       :....:||:.||..    ||.:|:::||..||.::|.|||::|:..|:
Mouse   383 DVTPERKDAQRDENEEHDDGGDRLTDGNTDSLPGILTVEEKKKIGHLCKLLIDQGRLQYLQQKGF 447

  Fly   408 QAELKFYVPRDVTLENVVLLARPTSP 433
            ...|::|....|:||||:|.|.|..|
Mouse   448 SPALQYYTDPLVSLENVLLTAVPAHP 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18048NP_649646.3 zf-TRM13_CCCH 20..44 CDD:288558 12/24 (50%)
zf-U11-48K 69..92 CDD:283028 15/23 (65%)
TRM13 183..429 CDD:282990 97/306 (32%)
Trmt13NP_084292.1 zf-TRM13_CCCH 17..45 CDD:288558 14/28 (50%)
zf-U11-48K 59..80 CDD:283028 14/21 (67%)
TRM13 165..469 CDD:282990 97/306 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255208978
eggNOG 1 0.900 E1_KOG2811
Hieranoid 1 1.000
Homologene 1 1.000 H6875
Inparanoid 1 1.050 242 1.000 Inparanoid score I3289
Isobase 1 0.950 0 Normalized mean entropy S2977
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003971
OrthoInspector 1 1.000 T1083417
orthoMCL 1 0.900 OOG5_129749
Panther 1 1.100 LDO PTHR12998
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1546
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.