DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18048 and trmt13

Sequence 1:NP_649646.3 Gene:CG18048 FlyBaseID:FBgn0037435 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001182604.1 Gene:trmt13 XenbaseID:XB-GENE-984691 Length:464 Species:Xenopus tropicalis

Alignment Length:462 Identity:166/463 (36%)
Similarity:244/463 (53%) Gaps:71/463 (15%)


  Fly    16 PVTTTCSYWVLRKKRRCKMTANKGSEFCGAHASSAATTATCDEKAREDSFQERIPCPLDHKHTVF 80
            |:...||::|.||||.|||..::|.:|||.||.|          ..|...:.|||||||.||||:
 Frog    26 PLPGRCSHFVQRKKRFCKMIVSEGKKFCGEHAQS----------GEEHDSRRRIPCPLDPKHTVY 80

  Fly    81 KRKLAKHLTICNARDQESSLPYIVKGVNSGDNLKETDEDLNKFNQIKLHELADEEFYSLIDKVKN 145
            :.:|.|||..||:|::...:.| |:.||:|..:.||.:     |||.|..|:.:|...|.:|:|.
 Frog    81 EDQLPKHLKKCNSREKPKPVFY-VQDVNAGCLITETPD-----NQISLSSLSKDELQELTEKLKQ 139

  Fly   146 LYDKHINSSIQELQLEHESLKEELSRKDYGQETLRQLTQTTSLLGILEHDHQLMDHTSYIEFGAG 210
            : ...::....:.:|.|.||.|.|:....|....:.|.|..|:||.|::...|.....::|||||
 Frog   140 V-TSGLDPPAADKKLCHWSLLEALNDPANGDTASKHLKQQASILGHLDNLGLLSGSCCFVEFGAG 203

  Fly   211 KGQLAYFLATVLQEQKLSHSQVVLIDRMSLRHKKDNKLANREVVQRIRADIADLKLSALPELKKT 275
            :|:|::::....|..:  :...:|::|.:.|.|.|.| ....|.:|::.||..|.|..:|.|.:.
 Frog   204 RGKLSHWVDIATQGSE--NINFLLVERATTRFKVDGK-QRSSVFERLQIDIQHLCLGRVPSLNEK 265

  Fly   276 Q-RTVAFSKHLCGAATDLTLRCI-----LGDG----------------------NASSDY----- 307
            | ..:...||||||.|||.|||:     |.:|                      .|:..|     
 Frog   266 QLPVIGIGKHLCGAGTDLALRCLMQSNSLANGEPFPKKPRTDTFEQGTVKNECDKANPAYSTCVG 330

  Fly   308 -VLIALCCHHRCSWRSYVGRKFLQEAGIGPREFVILTKMVSWAVCGTGLSRERRKAMESADFQL- 370
             :.|||||||||.|..||||:|.|..|:..|||.:..:|.|||.||..|.   .||::| |.|: 
 Frog   331 GIAIALCCHHRCDWHHYVGREFFQSLGLDQREFSLFQRMSSWATCGMRLP---AKAIQS-DEQME 391

  Fly   371 ------------TETNTQRLTRQEREQIGQQCKRVLDYGRLEHLRSHGYQAELKFYVPRDVTLEN 423
                        :||..:.||.:|||.:|:.||.::||||::.|:..||.|.|::|...:|:|||
 Frog   392 SEEHDAEQQNCHSETVERFLTVKERESLGRLCKLLIDYGRVDFLQRMGYIAALQYYTEPEVSLEN 456

  Fly   424 VVLLARP 430
            |:|.|.|
 Frog   457 VLLTAIP 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18048NP_649646.3 zf-TRM13_CCCH 20..44 CDD:288558 13/24 (54%)
zf-U11-48K 69..92 CDD:283028 15/23 (65%)
TRM13 183..429 CDD:282990 104/293 (35%)
trmt13NP_001182604.1 zf-TRM13_CCCH 29..57 CDD:288558 15/28 (54%)
zf-U11-48K 69..92 CDD:283028 15/23 (65%)
TRM13 176..461 CDD:282990 103/292 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255206079
eggNOG 1 0.900 E1_KOG2811
Hieranoid 1 1.000
Homologene 1 1.000 H6875
Inparanoid 1 1.050 255 1.000 Inparanoid score I2965
OMA 1 1.010
OrthoDB 1 1.010 D364329at33208
OrthoFinder 1 1.000 FOG0003971
OrthoInspector 1 1.000 T1059428
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1546
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.