DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and TFS1

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_013279.1 Gene:TFS1 SGDID:S000004168 Length:219 Species:Saccharomyces cerevisiae

Alignment Length:208 Identity:60/209 (29%)
Similarity:96/209 (46%) Gaps:49/209 (23%)


  Fly    24 FRSHQVVPDVIPE---PPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWD------------- 72
            ::.|.::.|||.:   .|:.:|.|.||::.....|..|...:.:.:|..::.             
Yeast    15 YKKHGILEDVIHDTSFQPSGILAVEYSSSAPVAMGNTLPTEKARSKPQFQFTFNKQMQKSVPQAN 79

  Fly    73 ---AQPGEFYTLIMTDPDAPSRAEPKFREFKHWI-----LANIAGNDLA-------------SGE 116
               .|..:.:||:||||||||:.:.|:.||.|.:     |.|.|.::.:             ...
Yeast    80 AYVPQDDDLFTLVMTDPDAPSKTDHKWSEFCHLVECDLKLLNEATHETSGATEFFASEFNTKGSN 144

  Fly   117 PIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDRPKF-------SAAKFAINHE 174
            .:.||:|..||:|:|.||||||||||...:  |..:.||  .||||.:       ...|:|..:.
Yeast   145 TLIEYMGPAPPKGSGPHRYVFLLYKQPKGV--DSSKFSK--IKDRPNWGYGTPATGVGKWAKENN 205

  Fly   175 LGNPIAGTFYQAQ 187
            | ..:|..|:.|:
Yeast   206 L-QLVASNFFYAE 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 54/186 (29%)
TFS1NP_013279.1 PEBP_euk 36..216 CDD:176644 54/185 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1615
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 1 1.000 T133827
orthoMCL 1 0.900 OOG5_127642
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2354
TreeFam 1 0.960
87.940

Return to query results.
Submit another query.