DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and FT

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001320342.1 Gene:FT AraportID:AT1G65480 Length:219 Species:Arabidopsis thaliana

Alignment Length:164 Identity:61/165 (37%)
Similarity:89/165 (54%) Gaps:15/165 (9%)


  Fly    28 QVVPDVIPEPPNQ--LLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQP-GEFYTLIMTDPDAP 89
            :||.||: :|.|:  .|||||....|. :|::|.|:||:::|.||...:. ..||||:|.|||.|
plant    57 RVVGDVL-DPFNRSITLKVTYGQREVT-NGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVP 119

  Fly    90 SRAEPKFREFKHWILANI-AGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERV 153
            |.:.|..||:.||::.:| |......|..|..|  ..|....|:||.||:|::|.|       |.
plant   120 SPSNPHLREYLHWLVTDIPATTGTTFGNEIVCY--ENPSPTAGIHRVVFILFRQLG-------RQ 175

  Fly   154 SKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQ 187
            :..:...|..|:..:||..:.||.|:|..||..|
plant   176 TVYAPGWRQNFNTREFAEIYNLGLPVAAVFYNCQ 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 54/147 (37%)
FTNP_001320342.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
OMA 1 1.010
OrthoDB 1 1.010 D1557122at2759
OrthoInspector 1 1.000 T32155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 1 0.910 0.667 Consistency score
77.080

Return to query results.
Submit another query.