DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and E12A11

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_173250.1 Gene:E12A11 AraportID:AT1G18100 Length:173 Species:Arabidopsis thaliana

Alignment Length:135 Identity:48/136 (35%)
Similarity:76/136 (56%) Gaps:8/136 (6%)


  Fly    54 DGVELTPTQVKDQPVVEWDAQPGEFYTLIMTDPDAPSRAEPKFREFKHWILANI-AGNDLASGEP 117
            :|.|:.|:...:.|.|.......|.|||:||||||||.:||..||:.|||:.:| .|.:.:.|:.
plant    38 NGCEIKPSTAVNPPKVNISGHSDELYTLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNPSRGKE 102

  Fly   118 IAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGT 182
            |..|:...||  .|:|||:.:|::|:..:....::...|:     .||...||.:.:||.|:|..
plant   103 ILPYMEPRPP--VGIHRYILVLFRQNSPVGLMVQQPPSRA-----NFSTRMFAGHFDLGLPVATV 160

  Fly   183 FYQAQ 187
            ::.||
plant   161 YFNAQ 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 46/133 (35%)
E12A11NP_173250.1 PEBP 6..173 CDD:294157 48/136 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
OMA 1 1.010
OrthoDB 1 1.010 D1557122at2759
OrthoInspector 1 1.000 T32155
orthoMCL 1 0.900 OOG5_127642
Panther 1 1.100 O PTHR11362
Phylome 1 0.910 0.600 Consistency score
87.980

Return to query results.
Submit another query.