DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and BFT

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_201010.1 Gene:BFT AraportID:AT5G62040 Length:177 Species:Arabidopsis thaliana

Alignment Length:190 Identity:64/191 (34%)
Similarity:97/191 (51%) Gaps:27/191 (14%)


  Fly     1 MLRVLLPL-VGCLLAVQAGSVEEVFRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVK 64
            |.|.:.|| ||.::    |.|.|:|.            |:..::||:::|.:..:|.||.|:.:.
plant     1 MSREIEPLIVGRVI----GDVLEMFN------------PSVTMRVTFNSNTIVSNGHELAPSLLL 49

  Fly    65 DQPVVEWDAQP-GEFYTLIMTDPDAPSRAEPKFREFKHWILANIAG-NDLASGEPIAEYIGSGPP 127
            .:|.||...|. ..|:||||.||||||.:.|..||:.||::.:|.| .|.:.|..|..|  ..|.
plant    50 SKPRVEIGGQDLRSFFTLIMMDPDAPSPSNPYMREYLHWMVTDIPGTTDASFGREIVRY--ETPK 112

  Fly   128 QGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQ 187
            ...|:|||||.|:||.|:      :..|.:.:.|..|:...|:....|..|:|..::.||
plant   113 PVAGIHRYVFALFKQRGR------QAVKAAPETRECFNTNAFSSYFGLSQPVAAVYFNAQ 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 51/147 (35%)
BFTNP_201010.1 PEBP 1..169 CDD:294157 64/191 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
OMA 1 1.010
OrthoDB 1 1.010 D1557122at2759
OrthoInspector 1 1.000 T32155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
66.170

Return to query results.
Submit another query.