DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and BFT

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_201010.1 Gene:BFT / 836324 AraportID:AT5G62040 Length:177 Species:Arabidopsis thaliana


Alignment Length:190 Identity:64/190 - (33%)
Similarity:97/190 - (51%) Gaps:27/190 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRVLLPL-VGCLLAVQAGSVEEVFRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVK 64
            |.|.:.|| ||.::    |.|.|:|.            |:..::||:::|.:..:|.||.|:.:.
plant     1 MSREIEPLIVGRVI----GDVLEMFN------------PSVTMRVTFNSNTIVSNGHELAPSLLL 49

  Fly    65 DQPVVEWDAQP-GEFYTLIMTDPDAPSRAEPKFREFKHWILANIAG-NDLASGEPIAEYIGSGPP 127
            .:|.||...|. ..|:||||.||||||.:.|..||:.||::.:|.| .|.:.|..|..|  ..|.
plant    50 SKPRVEIGGQDLRSFFTLIMMDPDAPSPSNPYMREYLHWMVTDIPGTTDASFGREIVRY--ETPK 112

  Fly   128 QGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQ 187
            ...|:|||||.|:||.|:      :..|.:.:.|..|:...|:....|..|:|..::.||
plant   113 PVAGIHRYVFALFKQRGR------QAVKAAPETRECFNTNAFSSYFGLSQPVAAVYFNAQ 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 51/146 (35%)
BFTNP_201010.1 PEBP 1..169 CDD:381878 64/190 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.