DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and TFL1

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_196004.1 Gene:TFL1 AraportID:AT5G03840 Length:177 Species:Arabidopsis thaliana

Alignment Length:190 Identity:62/191 (32%)
Similarity:95/191 (50%) Gaps:32/191 (17%)


  Fly     3 RVLLPLVGCLLAVQAGSVEEVFRSHQVVPDVIP-EPPNQLLKVTYSNNLVAKDGVELTPTQVKDQ 66
            ||:.||:                ..:||.||:. ..|...:.|:|:...|: :|.||.|:.|..:
plant     7 RVIEPLI----------------MGRVVGDVLDFFTPTTKMNVSYNKKQVS-NGHELFPSSVSSK 54

  Fly    67 PVVEWDAQPGE---FYTLIMTDPDAPSRAEPKFREFKHWILANIAG-NDLASGEPIAEYIGSGPP 127
            |.||  ...|:   |:||:|.|||.|..::|..:|..|||:.||.| .|...|:.:..|  ..|.
plant    55 PRVE--IHGGDLRSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSY--ELPR 115

  Fly   128 QGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQ 187
            ...|:||:||:|::|.      :.||...:...|..|:..|||:.::||.|:|..|:.||
plant   116 PSIGIHRFVFVLFRQK------QRRVIFPNIPSRDHFNTRKFAVEYDLGLPVAAVFFNAQ 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 51/149 (34%)
TFL1NP_196004.1 PEBP 4..177 CDD:294157 62/191 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
OMA 1 1.010
OrthoDB 1 1.010 D1557122at2759
OrthoInspector 1 1.000 T32155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
66.170

Return to query results.
Submit another query.