DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and AT5G01300

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_195750.1 Gene:AT5G01300 / 830983 AraportID:AT5G01300 Length:162 Species:Arabidopsis thaliana


Alignment Length:168 Identity:40/168 - (23%)
Similarity:64/168 - (38%) Gaps:45/168 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QLLKVTYSNN-------LVAKDGVELTPTQVKD-QPVVEWDAQPGEFYT--LIMTDPDAPSRAEP 94
            :|:..|..|:       .:|..||:      || .|.:||...|....|  |::.|.|||..:.|
plant     7 RLVSPTIDNDGKLPRKYTMAGQGVK------KDISPPLEWYNVPEGTKTLALVVEDIDAPDPSGP 65

  Fly    95 KFREFKHWILANI-----------AGND-----LASGEPIAEYIG-SGPPQGTGLHRYVFLLYKQ 142
             ...:..|::.:|           :||:     :..|....:..| .||...:..||:.|.|:..
plant    66 -LVPWTVWVVVDIPPEMKGLPEGYSGNEDQTTGIREGNNDHKIPGWRGPLLPSHGHRFQFKLFAL 129

  Fly   143 SGKLEFDEERVSKRSRKDRPKFSAAKFAI-NHELGNPI 179
            .     |:.::.....|:|     ...|| .|.||..|
plant   130 D-----DKPKIGHTVTKER-----LLIAIEGHVLGEAI 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 40/167 (24%)
AT5G01300NP_195750.1 PEBP_bact_arch 7..159 CDD:176643 40/168 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.