DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and TSF

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_193770.1 Gene:TSF AraportID:AT4G20370 Length:175 Species:Arabidopsis thaliana

Alignment Length:168 Identity:60/169 (36%)
Similarity:95/169 (56%) Gaps:19/169 (11%)


  Fly    29 VVPDVIPEPPNQL--LKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQP-GEFYTLIMTDPDAPS 90
            ||.||: :|..:|  |||||.:..|. :|::|.|:||.::|:||..... ..||||:|.|||.||
plant    14 VVGDVL-DPFTRLVSLKVTYGHREVT-NGLDLRPSQVLNKPIVEIGGDDFRNFYTLVMVDPDVPS 76

  Fly    91 RAEPKFREFKHWILANI---AGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEER 152
            .:.|..||:.||::.:|   .||  |.|..:..|....||  :|:||.|.:|::|.|       |
plant    77 PSNPHQREYLHWLVTDIPATTGN--AFGNEVVCYESPRPP--SGIHRIVLVLFRQLG-------R 130

  Fly   153 VSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDD 190
            .:..:...|.:|:..:||..:.||.|:|.:::..|.::
plant   131 QTVYAPGWRQQFNTREFAEIYNLGLPVAASYFNCQREN 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 54/151 (36%)
TSFNP_193770.1 PLN00169 1..175 CDD:177765 60/169 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
OMA 1 1.010
OrthoDB 1 1.010 D1557122at2759
OrthoInspector 1 1.000 T32155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 1 0.910 0.600 Consistency score
77.080

Return to query results.
Submit another query.