DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and ATC

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_180324.1 Gene:ATC AraportID:AT2G27550 Length:175 Species:Arabidopsis thaliana

Alignment Length:170 Identity:61/171 (36%)
Similarity:95/171 (56%) Gaps:25/171 (15%)


  Fly    28 QVVPDVIPEPPNQL----LKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQPGE---FYTLIMTD 85
            :|:.||:   .|.|    :.|||:::....:|.||.|:.|..:|.||  ...|:   |:||:|||
plant    13 RVIGDVV---DNCLQAVKMTVTYNSDKQVYNGHELFPSVVTYKPKVE--VHGGDMRSFFTLVMTD 72

  Fly    86 PDAPSRAEPKFREFKHWILANIAG-NDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQS--GKLE 147
            ||.|..::|..||..|||:.:|.| .|::.|:.|..|  ..|....|:||:|:||:||:  |.: 
plant    73 PDVPGPSDPYLREHLHWIVTDIPGTTDVSFGKEIIGY--EMPRPNIGIHRFVYLLFKQTRRGSV- 134

  Fly   148 FDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQ 187
                 ||..|.:|  :|:..:||..::||.|:|..|:..|
plant   135 -----VSVPSYRD--QFNTREFAHENDLGLPVAAVFFNCQ 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 56/155 (36%)
ATCNP_180324.1 PEBP 7..175 CDD:294157 61/171 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1557122at2759
OrthoInspector 1 1.000 T32155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
55.120

Return to query results.
Submit another query.