DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and Pebp4

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_082836.2 Gene:Pebp4 MGIID:1920773 Length:242 Species:Mus musculus

Alignment Length:129 Identity:44/130 (34%)
Similarity:71/130 (55%) Gaps:9/130 (7%)


  Fly    67 PVVEW-DAQPGEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLAS----GEPIAEYIGSGP 126
            |:|:: .|..|..|.|:|.|||||||:.|..:.::||:::||.|.|:.|    |..:::|....|
Mouse    99 PIVKFHTALDGALYLLVMVDPDAPSRSNPVMKYWRHWLVSNITGADMKSGSIRGNVLSDYSPPTP 163

  Fly   127 PQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDD 190
            |..||||||.|.:|.|..:    :..:|...:.|...::..||...:.|.:|...|.:..|:|:
Mouse   164 PPETGLHRYQFFVYLQGDR----DISLSVEEKADLGGWNLDKFLQQYGLRDPDTSTQFMTQFDE 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 42/124 (34%)
Pebp4NP_082836.2 PEBP_euk 95..219 CDD:176644 42/124 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86941456
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2354
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.