DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and Pebp4

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_008768114.2 Gene:Pebp4 RGDID:1593295 Length:272 Species:Rattus norvegicus

Alignment Length:132 Identity:45/133 (34%)
Similarity:72/133 (54%) Gaps:9/133 (7%)


  Fly    67 PVVEW-DAQPGEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLAS----GEPIAEYIGSGP 126
            |:|:: .|..|..|.|:|.|||||||:.|:.:.::||:::||.|.|:.|    |..|.:|....|
  Rat   129 PIVKFHGALDGAQYLLVMVDPDAPSRSNPRMKYWRHWVVSNITGTDMKSGSIRGNIITDYQPPTP 193

  Fly   127 PQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDDY 191
            |..||||||.|.:|.|..:    :..:.:...::|..:...||...:.|.:|...|.:..|:|..
  Rat   194 PPTTGLHRYQFFVYLQGDR----DISIPESENENRGAWKLDKFLQQYGLQDPDTSTQFMTQFDGE 254

  Fly   192 VP 193
            :|
  Rat   255 LP 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 42/124 (34%)
Pebp4XP_008768114.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.