DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and MRPL38

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_115867.2 Gene:MRPL38 HGNCID:14033 Length:380 Species:Homo sapiens

Alignment Length:203 Identity:65/204 (32%)
Similarity:97/204 (48%) Gaps:35/204 (17%)


  Fly    13 LAVQAGSVEEVFRSHQVVPDVIPEPPNQLLKVTYSNNLVAKD-------GVELTPTQVKDQPVVE 70
            ||...|...::|.....||.|    |   |.|.|:   |.:|       |.|:|||:....|.|.
Human   151 LAEYYGLYRDLFHGATFVPRV----P---LHVAYA---VGEDDLMPVYCGNEVTPTEAAQAPEVT 205

  Fly    71 WDAQPGEFYTLIMT-------DPDAPSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQ 128
            ::|:.|..:||::|       :|||         |:.||:|.||.||.:|.|:....|:...|.:
Human   206 YEAEEGSLWTLLLTSLDGHLLEPDA---------EYLHWLLTNIPGNRVAEGQVTCPYLPPFPAR 261

  Fly   129 GTGLHRYVFLLYKQSGKLEFDEE-RVSKRSRKDRPKFSAAKFAINH-ELGNPIAGTFYQAQYDDY 191
            |:|:||..|||:||...::|.|: |.|...:..:..|....|...| |...|...:|:|.::||.
Human   262 GSGIHRLAFLLFKQDQPIDFSEDARPSPCYQLAQRTFRTFDFYKKHQETMTPAGLSFFQCRWDDS 326

  Fly   192 VPKLHKQL 199
            |..:..||
Human   327 VTYIFHQL 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 52/161 (32%)
MRPL38NP_115867.2 PEBP_euk 171..321 CDD:176644 54/169 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.