DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and Mrpl38

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_077139.2 Gene:Mrpl38 MGIID:1926269 Length:380 Species:Mus musculus

Alignment Length:196 Identity:58/197 (29%)
Similarity:87/197 (44%) Gaps:21/197 (11%)


  Fly    13 LAVQAGSVEEVFRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQPGE 77
            ||...|...::|.....||.|   |.:....|...:.:....|.|:|||:....|.|.::|....
Mouse   151 LAEYYGLYRDLFHGATFVPWV---PLHVAYAVGEEDLIPVYHGNEVTPTEASRAPEVTYEADKDS 212

  Fly    78 FYTLI-------MTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRY 135
            .:||:       :.:|||         |:.||:|.||..|.:|.|:....|:...|.:|:|.||:
Mouse   213 LWTLLFINLDGHLLEPDA---------EYVHWLLTNIPSNRVAEGQETCPYLPPFPARGSGFHRF 268

  Fly   136 VFLLYKQSGKLEFDEE-RVSKRSRKDRPKFSAAKFAINH-ELGNPIAGTFYQAQYDDYVPKLHKQ 198
            .|||:||...:.|.|: |.|...:..:..|....|...| |...|....|:|.::||.|.....|
Mouse   269 AFLLFKQDKPINFSEDTRPSPCYQLAQRTFRTFDFYKRHQEAMTPAGLAFFQCRWDDSVTHTFHQ 333

  Fly   199 L 199
            |
Mouse   334 L 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 45/154 (29%)
Mrpl38NP_077139.2 PEBP_euk 171..321 CDD:176644 47/162 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.