DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and mrpl38

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_012814540.1 Gene:mrpl38 XenbaseID:XB-GENE-5959674 Length:406 Species:Xenopus tropicalis

Alignment Length:201 Identity:61/202 (30%)
Similarity:93/202 (46%) Gaps:31/202 (15%)


  Fly    13 LAVQAGSVEEVFRSHQVVPDVI----PEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDA 73
            :|...|..:::|.....||.|.    ....::.|...|..|||       ||.:....|.|.::|
 Frog   177 VAEHYGVFKDLFGDATFVPSVTLRVQYNKGDEFLMPVYHGNLV-------TPAEASGPPEVTFEA 234

  Fly    74 QPGEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFL 138
            :.|..:||::|:||...:....  |:..|::.||.||.:.|||.|..|....|.:|||.||::||
 Frog   235 EEGSLWTLLLTNPDGHLKETDS--EYVLWLVGNIPGNQVHSGEQICHYFPPFPAKGTGYHRHIFL 297

  Fly   139 LYKQSGKLEFDEERVSKRSRKDRPK---------FSAAKFAINHELGNPIAG-TFYQAQYDDYVP 193
            |:||..::||.:|.        ||.         |....|...:|.....|| .|:|..:||.|.
 Frog   298 LFKQDRRIEFKDEL--------RPNPCHSLKLRTFKTLDFYRKYEESLTPAGLAFFQCAWDDSVT 354

  Fly   194 KLHKQL 199
            :::.||
 Frog   355 QVYHQL 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 50/155 (32%)
mrpl38XP_012814540.1 PEBP_euk 197..347 CDD:176644 51/167 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.