DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and pebp1

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001016825.1 Gene:pebp1 XenbaseID:XB-GENE-973798 Length:186 Species:Xenopus tropicalis

Alignment Length:169 Identity:82/170 (48%)
Similarity:120/170 (71%) Gaps:2/170 (1%)


  Fly    34 IPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQP-VVEWDA-QPGEFYTLIMTDPDAPSRAEPKF 96
            :.|.|.|.|.|||.:..:.:.|..||||||:.:| .:||:. ...:.|||::||||||||..|||
 Frog    17 VEEKPAQPLLVTYGSLGIDELGQVLTPTQVQSRPSSIEWEGMDSSKLYTLVLTDPDAPSRKNPKF 81

  Fly    97 REFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDR 161
            ||:.|:::.|:.||::.||..:::|:|||||:||||||||:|:|:|:.:|:..|..:..||.:.|
 Frog    82 REWHHFLVVNMKGNNINSGCVLSDYVGSGPPKGTGLHRYVWLVYEQTEELKCTERVLCNRSGEHR 146

  Fly   162 PKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQLS 200
            ..|..|.|...::||.|:||..|||::|||||||::|||
 Frog   147 GMFKVASFRQKYKLGTPVAGNCYQAEWDDYVPKLYEQLS 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 68/147 (46%)
pebp1NP_001016825.1 PEBP_euk 24..171 CDD:176644 68/147 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86928057
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.