DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and Pebp1

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_651051.1 Gene:Pebp1 FlyBaseID:FBgn0038973 Length:176 Species:Drosophila melanogaster

Alignment Length:167 Identity:86/168 (51%)
Similarity:115/168 (68%) Gaps:1/168 (1%)


  Fly    29 VVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQPGEFYTLIMTDPDAPSRAE 93
            ::||:|...|.....:||.:.:..:.|.|||||||||||.|.:||:|...||:::.|||||||.:
  Fly     6 IIPDIIDVKPASKATITYPSGVQVELGKELTPTQVKDQPTVVFDAEPNSLYTILLVDPDAPSRED 70

  Fly    94 PKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSR 158
            |||||..||::.||.||.::.|:.||||||:||.:||||||||||::||:.|:. .|:.|||.||
  Fly    71 PKFRELLHWLVINIPGNKVSEGQTIAEYIGAGPREGTGLHRYVFLVFKQNDKIT-TEKFVSKTSR 134

  Fly   159 KDRPKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKL 195
            ..|....|..:...:..|.|:||.|:||||||||..|
  Fly   135 TGRINVKARDYIQKYSFGGPVAGNFFQAQYDDYVKTL 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 74/145 (51%)
Pebp1NP_651051.1 PEBP_euk 20..162 CDD:176644 74/143 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86935726
eggNOG 1 0.900 E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11362
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.