DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and CG7054

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_651050.1 Gene:CG7054 FlyBaseID:FBgn0038972 Length:179 Species:Drosophila melanogaster

Alignment Length:175 Identity:88/176 (50%)
Similarity:117/176 (66%) Gaps:5/176 (3%)


  Fly    29 VVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQPGE--FYTLIMTDPDAPSR 91
            :||||:...|...:||.|.::|..|.|.|||||||||||:|.|....|:  ..||:|.|||||:|
  Fly     4 IVPDVLDAVPAGTIKVIYGDDLEVKQGNELTPTQVKDQPIVSWSGLEGKSNLLTLLMVDPDAPTR 68

  Fly    92 AEPKFREFKHWILANIAGN--DLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVS 154
            .:||:||..||.:.||.|:  :.:.|..:|:|:|||||:.||||||:||||:|..|:| :...:|
  Fly    69 QDPKYREILHWSVVNIPGSNENPSGGHSLADYVGSGPPKDTGLHRYIFLLYRQENKIE-ETPTIS 132

  Fly   155 KRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQL 199
            ..:|..|..|:|..||..|.||.|||..:||||||||||..:|.:
  Fly   133 NTTRTGRLNFNARDFAAKHGLGEPIAANYYQAQYDDYVPIRNKTI 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 74/149 (50%)
CG7054NP_651050.1 PEBP_euk 15..164 CDD:176644 74/150 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86935770
eggNOG 1 0.900 E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11362
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.