DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and CG10298

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_649643.1 Gene:CG10298 FlyBaseID:FBgn0037432 Length:187 Species:Drosophila melanogaster

Alignment Length:177 Identity:102/178 (57%)
Similarity:130/178 (73%) Gaps:0/178 (0%)


  Fly    24 FRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQPGEFYTLIMTDPDA 88
            |..|::|||::...|..||.|||....|...|.|||||||:.||.|:|||.|..||||::|||||
  Fly     8 FSKHKIVPDILKTCPATLLTVTYGGGQVVDVGGELTPTQVQSQPKVKWDADPNAFYTLLLTDPDA 72

  Fly    89 PSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERV 153
            |||.||||||:.||::.||.||.:.:|..:.||:|:||||||||||||||::||..||..:|.::
  Fly    73 PSRKEPKFREWHHWLVVNIPGNQVENGVVLTEYVGAGPPQGTGLHRYVFLVFKQPQKLTCNEPKI 137

  Fly   154 SKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQLS 200
            .|.|...|..||.:||...::||:||||.|:|||:|||||||:||||
  Fly   138 PKTSGDKRANFSTSKFMSKYKLGDPIAGNFFQAQWDDYVPKLYKQLS 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 83/145 (57%)
CG10298NP_649643.1 PEBP_euk 24..170 CDD:176644 83/146 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134537520
eggNOG 1 0.900 E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
orthoMCL 1 0.900 OOG5_127642
Panther 1 1.100 P PTHR11362
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2354
87.920

Return to query results.
Submit another query.