DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and pebp1

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_998488.1 Gene:pebp1 / 406627 ZFINID:ZDB-GENE-040426-2621 Length:187 Species:Danio rerio


Alignment Length:169 Identity:80/169 - (47%)
Similarity:121/169 - (71%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPV-VEWD-AQPGEFYTLIMTDPDAPSRAEPKF 96
            :.|||.:.|.|.|.:..:...|...|||||:::|. :||: ..|.:.|||.|||||||||.:|||
Zfish    17 VEEPPAKPLTVKYDSVEIDSLGKVCTPTQVQNRPTSIEWEGCDPSKLYTLAMTDPDAPSRKDPKF 81

  Fly    97 REFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDR 161
            ||:.|:::.|:.|||::||..:::|:|:|||:||||||||:|:|:|||.:...|..::.||..:|
Zfish    82 REWHHFLVVNVKGNDVSSGCVMSDYVGAGPPKGTGLHRYVWLVYEQSGNISCTERVLTNRSGDNR 146

  Fly   162 PKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQLS 200
            .||....|...:.||.|:||:.:||::|:|||||::||:
Zfish   147 GKFKIQSFRKKYSLGAPLAGSCFQAEWDNYVPKLYEQLA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 67/146 (46%)
pebp1NP_998488.1 PEBP_euk 23..171 CDD:176644 67/147 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I3688
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - otm25702
orthoMCL 1 0.900 - - OOG6_101885
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2354
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.