DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and pebp1

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_998488.1 Gene:pebp1 ZFINID:ZDB-GENE-040426-2621 Length:187 Species:Danio rerio

Alignment Length:169 Identity:80/170 (47%)
Similarity:121/170 (71%) Gaps:2/170 (1%)


  Fly    34 IPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPV-VEWD-AQPGEFYTLIMTDPDAPSRAEPKF 96
            :.|||.:.|.|.|.:..:...|...|||||:::|. :||: ..|.:.|||.|||||||||.:|||
Zfish    17 VEEPPAKPLTVKYDSVEIDSLGKVCTPTQVQNRPTSIEWEGCDPSKLYTLAMTDPDAPSRKDPKF 81

  Fly    97 REFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDR 161
            ||:.|:::.|:.|||::||..:::|:|:|||:||||||||:|:|:|||.:...|..::.||..:|
Zfish    82 REWHHFLVVNVKGNDVSSGCVMSDYVGAGPPKGTGLHRYVWLVYEQSGNISCTERVLTNRSGDNR 146

  Fly   162 PKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQLS 200
            .||....|...:.||.|:||:.:||::|:|||||::||:
Zfish   147 GKFKIQSFRKKYSLGAPLAGSCFQAEWDNYVPKLYEQLA 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 68/147 (46%)
pebp1NP_998488.1 PEBP_euk 23..171 CDD:176644 68/148 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I3621
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 1 1.000 T597478
orthoMCL 1 0.900 OOG5_127642
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2354
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.