DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and CG6180

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_609588.1 Gene:CG6180 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster

Alignment Length:196 Identity:105/197 (53%)
Similarity:133/197 (68%) Gaps:3/197 (2%)


  Fly     7 PLVGCLLAVQAGSVEEV---FRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPV 68
            |:...:.:.:..|.|:|   ...|.||||||.:.|.|...|.|..::|.|.|..||||||||:|.
  Fly    60 PIFAFIASQRQYSCEKVGKTMEEHCVVPDVIAKAPAQTAVVEYPGDIVVKPGQVLTPTQVKDEPC 124

  Fly    69 VEWDAQPGEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLH 133
            |:|:|...:.|||.|||||||||.:|||||:.||::.||.|.|:|.||.::.|:|||||..||||
  Fly   125 VKWEADANKLYTLCMTDPDAPSRKDPKFREWHHWLVGNIPGGDVAKGEVLSAYVGSGPPPDTGLH 189

  Fly   134 RYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQ 198
            |||||:|:|..||.|||:|:...|...|..|..|:||..:.|||||||..|||:||||||.|:||
  Fly   190 RYVFLIYEQRCKLTFDEKRLPNNSGDGRGGFKIAEFAKKYALGNPIAGNLYQAEYDDYVPILYKQ 254

  Fly   199 L 199
            |
  Fly   255 L 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 81/145 (56%)
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 81/142 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86933219
eggNOG 1 0.900 E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
orthoMCL 1 0.900 OOG5_127642
Panther 1 1.100 P PTHR11362
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2354
87.920

Return to query results.
Submit another query.