DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and Mrpl38

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001009369.2 Gene:Mrpl38 RGDID:1311180 Length:380 Species:Rattus norvegicus

Alignment Length:209 Identity:58/210 (28%)
Similarity:86/210 (41%) Gaps:47/210 (22%)


  Fly    13 LAVQAGSVEEVFRSHQVVP-------------DVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVK 64
            ||...|...::|.....||             |:||         .|..|       |:|||:..
  Rat   151 LAEYYGLYRDLFHGATFVPWVPLHVAYALGEEDLIP---------VYHGN-------EVTPTEAS 199

  Fly    65 DQPVVEWDAQPGEFYTLI-------MTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPIAEYI 122
            ..|.|.::|.....:||:       :.:|||         |:.||::.||..|.:|.|:....|:
  Rat   200 QAPEVTYEADKDSLWTLLFINLDGHLLEPDA---------EYLHWLVTNIPSNRVAEGQESCPYL 255

  Fly   123 GSGPPQGTGLHRYVFLLYKQSGKLEFDEE-RVSKRSRKDRPKFSAAKFAINH-ELGNPIAGTFYQ 185
            ...|.:|:|.||:.|||:||...:.|.|: |.|...:..:..|....|...| |...|....|:|
  Rat   256 PPFPARGSGFHRFAFLLFKQDKPINFSEDTRPSPCYQLAQRTFHTLDFYKKHQEAMTPAGLAFFQ 320

  Fly   186 AQYDDYVPKLHKQL 199
            .::||.|.....||
  Rat   321 CRWDDSVTHTFHQL 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 44/154 (29%)
Mrpl38NP_001009369.2 PEBP_euk 171..321 CDD:176644 47/175 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.