DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and Pebp1

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_058932.1 Gene:Pebp1 RGDID:62017 Length:187 Species:Rattus norvegicus

Alignment Length:169 Identity:85/170 (50%)
Similarity:118/170 (69%) Gaps:2/170 (1%)


  Fly    34 IPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQP-VVEWDA-QPGEFYTLIMTDPDAPSRAEPKF 96
            :.|||...|:|.|....|.:.|..||||||.::| .:.||. .||:.|||::||||||||.:|||
  Rat    17 VDEPPQHALRVDYGGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKF 81

  Fly    97 REFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDR 161
            ||:.|:::.|:.|||::||..::||:|||||:.|||||||:|:|:|...|..||..:|.:|..:|
  Rat    82 REWHHFLVVNMKGNDISSGTVLSEYVGSGPPKDTGLHRYVWLVYEQEQPLNCDEPILSNKSGDNR 146

  Fly   162 PKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQLS 200
            .||....|...:.||.|:|||.:||::||.|||||.||:
  Rat   147 GKFKVESFRKKYHLGAPVAGTCFQAEWDDSVPKLHDQLA 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 72/147 (49%)
Pebp1NP_058932.1 PEBP_euk 25..171 CDD:176644 72/146 (49%)
Interaction with RAF1. {ECO:0000250} 93..134 23/41 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 1 1.000 T131281
orthoMCL 1 0.900 OOG5_127642
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
87.880

Return to query results.
Submit another query.