DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and SPBC2F12.10

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001342831.1 Gene:SPBC2F12.10 PomBaseID:SPBC2F12.10 Length:308 Species:Schizosaccharomyces pombe

Alignment Length:130 Identity:31/131 (24%)
Similarity:56/131 (43%) Gaps:16/131 (12%)


  Fly    79 YTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPI---AEYIGSGPP---QGTGLHRYVF 137
            |::|..|.|.|:....:|....:|:|.||. .:.:...||   ..:....||   :|...||.:.
pombe   173 YSVITLDLDVPNYETNRFETHCNWLLTNIP-IEASKRVPIDTSKAFFQYRPPIVHRGEDKHRILT 236

  Fly   138 LLYKQ-SGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYD-DYVPKLHKQLS 200
            |:.:| |..:......:.      |.:|..::|...::| .|:....:::.:| |.|..|.|..|
pombe   237 LVLRQKSSSISIPSNALV------RERFDLSEFCSIYDL-EPVGAHLWRSGWDSDAVALLSKHPS 294

  Fly   201  200
            pombe   295  294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 25/114 (22%)
SPBC2F12.10NP_001342831.1 PEBP_euk 130..279 CDD:176644 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.