DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and CG30060

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_725293.1 Gene:CG30060 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster

Alignment Length:181 Identity:55/182 (30%)
Similarity:91/182 (50%) Gaps:3/182 (2%)


  Fly     8 LVGCLLAVQAGSVEEVFRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWD 72
            ||.|.:......:....:.|.|:|.:....|.:::.|.|..::..|.|:.:...:...||::.:.
  Fly     2 LVSCPILCPVEKLVTELKRHHVIPRLFACKPTKVISVLYPCDIDIKPGIMVVINETLKQPIIRFK 66

  Fly    73 AQPGEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVF 137
            |.|..::||:|.|.|.|   .....|:..|::.||.|.|:|.|:.:..|.......|:.:||.||
  Fly    67 ADPEHYHTLMMVDLDVP---PDNNTEWLIWMVGNIPGCDVAMGQTLVAYDNRRTIHGSNIHRIVF 128

  Fly   138 LLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQY 188
            |.:||..:|:|||..|.:...|.|..|:...||..:.||||:|..||..::
  Fly   129 LAFKQYLELDFDETFVPEGEEKGRGTFNCHNFARKYALGNPMAANFYLVEW 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 48/145 (33%)
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 48/146 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86935852
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1615
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11362
RoundUp 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.