DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and Pebp1

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_061346.2 Gene:Pebp1 MGIID:1344408 Length:187 Species:Mus musculus

Alignment Length:169 Identity:87/170 (51%)
Similarity:121/170 (71%) Gaps:2/170 (1%)


  Fly    34 IPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQP-VVEWDA-QPGEFYTLIMTDPDAPSRAEPKF 96
            :.|||...|:|.|:...|.:.|..||||||.::| .:.||. .||:.|||::||||||||.:|||
Mouse    17 VDEPPQHALRVDYAGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKF 81

  Fly    97 REFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDR 161
            ||:.|:::.|:.|||::||..:::|:|||||.||||||||:|:|:|...|..||..:|.:|..:|
Mouse    82 REWHHFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRYVWLVYEQEQPLSCDEPILSNKSGDNR 146

  Fly   162 PKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQLS 200
            .||....|...:.||.|:|||.|||::|||||||::|||
Mouse   147 GKFKVETFRKKYNLGAPVAGTCYQAEWDDYVPKLYEQLS 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 73/147 (50%)
Pebp1NP_061346.2 PEBP_euk 25..171 CDD:176644 73/146 (50%)
Interaction with RAF1. {ECO:0000250} 93..134 23/41 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 1 1.000 T131027
orthoMCL 1 0.900 OOG5_127642
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2354
TreeFam 1 0.960
76.890

Return to query results.
Submit another query.