DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and Y69E1A.5

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_502042.1 Gene:Y69E1A.5 WormBaseID:WBGene00013477 Length:172 Species:Caenorhabditis elegans

Alignment Length:183 Identity:55/184 (30%)
Similarity:89/184 (48%) Gaps:28/184 (15%)


  Fly    20 VEEVFRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTP------TQVKDQPVVEW---DAQP 75
            :...|..|::.|.:|...|.|.|.:.:       ||:::.|      ..:|:.|  .|   .|.|
 Worm     4 ISAAFAQHEITPKIIENAPKQKLHLCW-------DGIQVEPGMTMQVRNLKNAP--RWALPGADP 59

  Fly    76 GEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLA----SGEPIAEYIGSGPPQGTGLHRYV 136
            ...||::|.|||..||..|...|:.||::.||..:::.    .|:....|....|...|.|||||
 Worm    60 ESIYTVLMIDPDNLSRKNPSVAEWLHWLVCNIPASNIIDGINGGQHQMAYGSPAPGPRTDLHRYV 124

  Fly   137 FLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYD 189
            .|:::.:|:      |:|......|.||:..:|...::||:||||.|:.||::
 Worm   125 ILMWEHAGR------RISVPKPSSRAKFNVKQFIEKNKLGDPIAGNFFLAQHE 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 47/158 (30%)
Y69E1A.5NP_502042.1 PEBP_euk 25..168 CDD:176644 47/158 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.