DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and PEBP4

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001350162.1 Gene:PEBP4 / 157310 HGNCID:28319 Length:227 Species:Homo sapiens


Alignment Length:213 Identity:60/213 - (28%)
Similarity:91/213 - (42%) Gaps:53/213 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVGCLLAVQAGSVEEVFRSHQVVPD----------------------VIPEPPNQLLKVTYSNNL 50
            |:|.::.|.....|....:|:.:.|                      |:|:..|...|:|...  
Human    13 LLGLMMVVTGDEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQKITSWM-- 75

  Fly    51 VAKDGVELTPTQVKDQPVVEW-DAQPGEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDL-- 112
                           :|:|:: .|..|..|.|:|.||||||||||:.|.::||::.:|.|.||  
Human    76 ---------------EPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKGADLKK 125

  Fly   113 --ASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVS--KRSRKDRPKFSAAKFAINH 173
              ..|:.::.|....||..:|.|||.|.:|.|.||:      :|  .:..|.|..:...:|....
Human   126 GKIQGQELSAYQAPSPPAHSGFHRYQFFVYLQEGKV------ISLLPKENKTRGSWKMDRFLNRF 184

  Fly   174 ELGNPIAGTFYQAQ-YDD 190
            .||.|.|.|.:..| |.|
Human   185 HLGEPEASTQFMTQNYQD 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 48/151 (32%)
PEBP4NP_001350162.1 PEBP_euk 46..197 CDD:176644 51/173 (29%)
Important for secretion. /evidence=ECO:0000269|PubMed:27033522 188..227 6/15 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..227 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149343
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2354
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.