DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and pebp4

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_005170845.2 Gene:pebp4 ID: Length:194 Species:Danio rerio

Alignment Length:130 Identity:47/131 (36%)
Similarity:71/131 (54%) Gaps:16/131 (12%)


  Fly    42 LKVTYSNNLVAKDGVELTPTQVKDQPVVEW--------DAQPGEFYTLIMTDPDAPSRAEPKFRE 98
            |||.|.:.:|  |...:.|.:.:::..:||        .|:..:.|||:|.|||||||..|....
Zfish    38 LKVIYPDLVV--DKCLIVPQRTREKISMEWGSPEVLLPHAEEEKKYTLVMVDPDAPSRQNPSRSY 100

  Fly    99 FKHWILANIAGNDLASGE----PIAEYIGSGPPQGTGLHRYVFLLYKQ-SGKLEFDEERVSKRSR 158
            ::||:|.:|.|..|.:|:    .::.|....||:|||||||..|:::| .|:..| ..|...|||
Zfish   101 WRHWLLVDIKGEALQTGDVRGTELSAYARPTPPKGTGLHRYQILVFEQPEGRTPF-LNREENRSR 164

  Fly   159  158
            Zfish   165  164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 47/131 (36%)
pebp4XP_005170845.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2354
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.140

Return to query results.
Submit another query.