DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and LOC100497751

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_002938131.1 Gene:LOC100497751 ID: Length:185 Species:Xenopus tropicalis

Alignment Length:167 Identity:76/168 (45%)
Similarity:111/168 (66%) Gaps:1/168 (1%)


  Fly    34 IPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDA-QPGEFYTLIMTDPDAPSRAEPKFR 97
            :.|.|...|||.:.:..|.:.|..||||||:..|.:||:: ...:.||:|.||||.|||.|....
 Frog    17 VEEQPKYPLKVAFGSVCVEELGQVLTPTQVQHCPNIEWESMDSSKLYTVIFTDPDVPSRKECHLG 81

  Fly    98 EFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDRP 162
            |:.|::..|:.||||:||..:..|:||||.:|||||||..|:|:|:|:::..|..:...|.:.|.
 Frog    82 EWHHFLAVNVKGNDLSSGCILTAYVGSGPGKGTGLHRYTILVYEQAGRVQCTERILGNTSAEHRG 146

  Fly   163 KFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQL 199
            ||.|::|...::|..|||||.:||::||:||||:|||
 Frog   147 KFKASEFRKKYKLAAPIAGTCFQAEWDDHVPKLYKQL 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 64/146 (44%)
LOC100497751XP_002938131.1 PEBP_euk 24..170 CDD:176644 64/146 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.