DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17919 and pebp4

DIOPT Version :9

Sequence 1:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_002932751.1 Gene:pebp4 / 100488878 XenbaseID:XB-GENE-941751 Length:202 Species:Xenopus tropicalis


Alignment Length:222 Identity:72/222 - (32%)
Similarity:101/222 - (45%) Gaps:61/222 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRVLLPLVG--------CLLAVQAGSVEEVFRSHQ----------VVPDV-------IP---EP 37
            |.|:.|||:.        |.|..:..|:.::|.::.          :.||:       ||   :.
 Frog     1 MARIWLPLLALLSLAAHFCTLQAEECSIRKLFNANDEKFCSKDLDVIYPDIGRVSCIYIPNCFDF 65

  Fly    38 PNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWD-AQPGEFYTLIMTDPDAPSRAEPKFREFKH 101
            |..|:||.                   |.|::.:. ||||..|.|||.|||||||.:||:|.::|
 Frog    66 PRSLIKVW-------------------DYPLLRYSKAQPGLKYVLIMVDPDAPSRWDPKYRYWRH 111

  Fly   102 WILANIAGNDLAS-----GEPIAEYIGSGPPQGTGLHRYVFLLYKQS--GKLEFDEERVSKRSRK 159
            |:|.:|.|..|.|     |..|:.|....||.|||.|||.|.||:|.  ..|.|..|.: :||..
 Frog   112 WVLTDIPGWQLLSGRDLTGNDISAYRRPSPPPGTGYHRYQFYLYEQPLWVILYFLPEEI-RRSTW 175

  Fly   160 DRPKFSAAKFAINHELGNPIAGTFYQA 186
            |     ...|...::||.|:|.|.:.|
 Frog   176 D-----LKAFVQRNKLGEPVATTQFLA 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 57/152 (38%)
pebp4XP_002932751.1 PEBP_euk 42..197 CDD:176644 62/179 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2354
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.