DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17919 and pebp4

Sequence 1:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_002932751.1 Gene:pebp4 XenbaseID:XB-GENE-941751 Length:202 Species:Xenopus tropicalis

Alignment Length:222 Identity:72/223 (32%)
Similarity:101/223 (45%) Gaps:61/223 (27%)


  Fly     1 MLRVLLPLVG--------CLLAVQAGSVEEVFRSHQ----------VVPDV-------IP---EP 37
            |.|:.|||:.        |.|..:..|:.::|.::.          :.||:       ||   :.
 Frog     1 MARIWLPLLALLSLAAHFCTLQAEECSIRKLFNANDEKFCSKDLDVIYPDIGRVSCIYIPNCFDF 65

  Fly    38 PNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWD-AQPGEFYTLIMTDPDAPSRAEPKFREFKH 101
            |..|:||.                   |.|::.:. ||||..|.|||.|||||||.:||:|.::|
 Frog    66 PRSLIKVW-------------------DYPLLRYSKAQPGLKYVLIMVDPDAPSRWDPKYRYWRH 111

  Fly   102 WILANIAGNDLAS-----GEPIAEYIGSGPPQGTGLHRYVFLLYKQS--GKLEFDEERVSKRSRK 159
            |:|.:|.|..|.|     |..|:.|....||.|||.|||.|.||:|.  ..|.|..|.: :||..
 Frog   112 WVLTDIPGWQLLSGRDLTGNDISAYRRPSPPPGTGYHRYQFYLYEQPLWVILYFLPEEI-RRSTW 175

  Fly   160 DRPKFSAAKFAINHELGNPIAGTFYQA 186
            |     ...|...::||.|:|.|.:.|
 Frog   176 D-----LKAFVQRNKLGEPVATTQFLA 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 57/153 (37%)
pebp4XP_002932751.1 PEBP_euk 42..197 CDD:176644 62/180 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86941177
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2354
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.