DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and YLR179C

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_013280.1 Gene:YLR179C SGDID:S000004169 Length:201 Species:Saccharomyces cerevisiae

Alignment Length:190 Identity:52/191 (27%)
Similarity:83/191 (43%) Gaps:41/191 (21%)


  Fly    18 SDTEVSKIMRSLDVIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQV---RDEPSVKWPS---- 75
            |...|:|:.:. |:|.|.:.....|.|......::.:...|:..||.:   :..|::|:..    
Yeast     2 SSAIVAKLNKE-DIIKDTVKDLAFEILGELSVSYVDSDDIKLGNPMPMEATQAAPTIKFTPFDKS 65

  Fly    76 --APENYYALLMVDPDVPNAITPTHREFLHWMVLNI-----PGNLLAL---GDVRVGYMGATPLK 130
              :.|:..||||.|||.|:.......|..|:::.:|     ||..:|:   |.||..|:|..|.|
Yeast    66 QLSAEDKLALLMTDPDAPSRTEHKWSEVCHYIITDIPVEYGPGGDIAISGKGVVRNNYIGPGPPK 130

  Fly   131 GTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFETKRFAK-----KYRFGHPVAGNF 185
            .:|.||:||.|.||           ||       |.::..|.|     .:.:|.|.||.:
Yeast   131 NSGYHRYVFFLCKQ-----------PK-------GADSSTFTKVENIISWGYGTPGAGAY 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 45/165 (27%)
YLR179CNP_013280.1 PEBP_euk 30..190 CDD:176644 44/162 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4806132
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1615
Isobase 1 0.950 0 Normalized mean entropy S1728
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 1 1.000 T133827
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.890

Return to query results.
Submit another query.