DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and FT

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001320342.1 Gene:FT AraportID:AT1G65480 Length:219 Species:Arabidopsis thaliana

Alignment Length:211 Identity:67/212 (32%)
Similarity:94/212 (44%) Gaps:38/212 (18%)


  Fly     3 FAPSLSLKSTRGVHQSDTEV---------SKIMRSLD---------VIPDVIH-IGPQEFLNVTY 48
            |.|.:.:|... ...|.||.         |:...|::         |:.||:. ......|.|||
plant    13 FMPMIQIKEAE-TKTSKTETINTEKPPVCSRSKMSINIRDPLIVSRVVGDVLDPFNRSITLKVTY 76

  Fly    49 HGHLAAHCGKVLEPMQVRDEPSVKWPSAP-ENYYALLMVDPDVPNAITPTHREFLHWMVLNIPGN 112
             |......|..|.|.||:::|.|:..... .|:|.|:|||||||:...|..||:|||:|.:||..
plant    77 -GQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSPSNPHLREYLHWLVTDIPAT 140

  Fly   113 L-LALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKG---RSGFETKRFAK 173
            . ...|:..|.|...:|.  .|.||.||:|::|          |.:.:|..   |..|.|:.||:
plant   141 TGTTFGNEIVCYENPSPT--AGIHRVVFILFRQ----------LGRQTVYAPGWRQNFNTREFAE 193

  Fly   174 KYRFGHPVAGNFFTSQ 189
            .|..|.|||..|:..|
plant   194 IYNLGLPVAAVFYNCQ 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 55/149 (37%)
FTNP_001320342.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
OMA 1 1.010
OrthoDB 1 1.010 D1557122at2759
OrthoInspector 1 1.000 T32155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 1 0.910 0.667 Consistency score
77.080

Return to query results.
Submit another query.