DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and E12A11

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_173250.1 Gene:E12A11 / 838390 AraportID:AT1G18100 Length:173 Species:Arabidopsis thaliana


Alignment Length:185 Identity:48/185 - (25%)
Similarity:74/185 - (40%) Gaps:52/185 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VIPDV-----------IHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALL 84
            ||.||           ::.||:...|           |..::|....:.|.|......:..|.|:
plant    13 VIGDVLDMFIPTANMSVYFGPKHITN-----------GCEIKPSTAVNPPKVNISGHSDELYTLV 66

  Fly    85 MVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKG------------TGTHRF 137
            |.|||.|:...|..||::||:|::|||             |..|.:|            .|.||:
plant    67 MTDPDAPSPSEPNMREWVHWIVVDIPG-------------GTNPSRGKEILPYMEPRPPVGIHRY 118

  Fly   138 VFLLYKQRDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSP 192
            :.:|::|.........:.|     .|:.|.|:.||..:..|.|||..:|.:|..|
plant   119 ILVLFRQNSPVGLMVQQPP-----SRANFSTRMFAGHFDLGLPVATVYFNAQKEP 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 40/155 (26%)
E12A11NP_173250.1 PEBP 6..173 CDD:412238 48/185 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.