DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and E12A11

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_173250.1 Gene:E12A11 AraportID:AT1G18100 Length:173 Species:Arabidopsis thaliana

Alignment Length:185 Identity:48/186 (26%)
Similarity:74/186 (40%) Gaps:52/186 (28%)


  Fly    31 VIPDV-----------IHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALL 84
            ||.||           ::.||:...|           |..::|....:.|.|......:..|.|:
plant    13 VIGDVLDMFIPTANMSVYFGPKHITN-----------GCEIKPSTAVNPPKVNISGHSDELYTLV 66

  Fly    85 MVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKG------------TGTHRF 137
            |.|||.|:...|..||::||:|::|||             |..|.:|            .|.||:
plant    67 MTDPDAPSPSEPNMREWVHWIVVDIPG-------------GTNPSRGKEILPYMEPRPPVGIHRY 118

  Fly   138 VFLLYKQRDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSP 192
            :.:|::|.........:.|     .|:.|.|:.||..:..|.|||..:|.:|..|
plant   119 ILVLFRQNSPVGLMVQQPP-----SRANFSTRMFAGHFDLGLPVATVYFNAQKEP 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 40/156 (26%)
E12A11NP_173250.1 PEBP 6..173 CDD:294157 48/186 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
OMA 1 1.010
OrthoDB 1 1.010 D1557122at2759
OrthoInspector 1 1.000 T32155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 1 0.910 0.600 Consistency score
77.080

Return to query results.
Submit another query.