DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and BFT

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_201010.1 Gene:BFT AraportID:AT5G62040 Length:177 Species:Arabidopsis thaliana

Alignment Length:166 Identity:54/167 (32%)
Similarity:80/167 (48%) Gaps:19/167 (11%)


  Fly    31 VIPDVIHI-GPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAP-ENYYALLMVDPDVPNA 93
            ||.||:.: .|...:.||::.:.....|..|.|..:..:|.|:..... .:::.|:|:|||.|:.
plant    13 VIGDVLEMFNPSVTMRVTFNSNTIVSNGHELAPSLLLSKPRVEIGGQDLRSFFTLIMMDPDAPSP 77

  Fly    94 ITPTHREFLHWMVLNIPGNL-LALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPK 157
            ..|..||:|||||.:|||.. .:.|...|.|  .||....|.||:||.|:|||.          :
plant    78 SNPYMREYLHWMVTDIPGTTDASFGREIVRY--ETPKPVAGIHRYVFALFKQRG----------R 130

  Fly   158 HSVKG----RSGFETKRFAKKYRFGHPVAGNFFTSQ 189
            .:||.    |..|.|..|:..:....|||..:|.:|
plant   131 QAVKAAPETRECFNTNAFSSYFGLSQPVAAVYFNAQ 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 48/150 (32%)
BFTNP_201010.1 PEBP 1..169 CDD:294157 54/167 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
OMA 1 1.010
OrthoDB 1 1.010 D1557122at2759
OrthoInspector 1 1.000 T32155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
66.170

Return to query results.
Submit another query.