DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and TFL1

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_196004.1 Gene:TFL1 / 831683 AraportID:AT5G03840 Length:177 Species:Arabidopsis thaliana


Alignment Length:162 Identity:59/162 - (36%)
Similarity:85/162 - (52%) Gaps:12/162 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VIPDVI-HIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAP-ENYYALLMVDPDVPNA 93
            |:.||: ...|...:||:|:....:: |..|.|..|..:|.|:..... .:::.|:|:|||||..
plant    17 VVGDVLDFFTPTTKMNVSYNKKQVSN-GHELFPSSVSSKPRVEIHGGDLRSFFTLVMIDPDVPGP 80

  Fly    94 ITPTHREFLHWMVLNIPGNLLA-LGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPK 157
            ..|..:|.|||:|.||||...| .|...|.|  ..|....|.|||||:|::|:. .:..||.:| 
plant    81 SDPFLKEHLHWIVTNIPGTTDATFGKEVVSY--ELPRPSIGIHRFVFVLFRQKQ-RRVIFPNIP- 141

  Fly   158 HSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQ 189
                .|..|.|::||.:|..|.|||..||.:|
plant   142 ----SRDHFNTRKFAVEYDLGLPVAAVFFNAQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 54/145 (37%)
TFL1NP_196004.1 PEBP 4..177 CDD:412238 59/162 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.