DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and TFL1

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_196004.1 Gene:TFL1 AraportID:AT5G03840 Length:177 Species:Arabidopsis thaliana

Alignment Length:162 Identity:59/163 (36%)
Similarity:85/163 (52%) Gaps:12/163 (7%)


  Fly    31 VIPDVI-HIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAP-ENYYALLMVDPDVPNA 93
            |:.||: ...|...:||:|:....:: |..|.|..|..:|.|:..... .:::.|:|:|||||..
plant    17 VVGDVLDFFTPTTKMNVSYNKKQVSN-GHELFPSSVSSKPRVEIHGGDLRSFFTLVMIDPDVPGP 80

  Fly    94 ITPTHREFLHWMVLNIPGNLLA-LGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPK 157
            ..|..:|.|||:|.||||...| .|...|.|  ..|....|.|||||:|::|:. .:..||.:| 
plant    81 SDPFLKEHLHWIVTNIPGTTDATFGKEVVSY--ELPRPSIGIHRFVFVLFRQKQ-RRVIFPNIP- 141

  Fly   158 HSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQ 189
                .|..|.|::||.:|..|.|||..||.:|
plant   142 ----SRDHFNTRKFAVEYDLGLPVAAVFFNAQ 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 54/146 (37%)
TFL1NP_196004.1 PEBP 4..177 CDD:294157 59/163 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
OMA 1 1.010
OrthoDB 1 1.010 D1557122at2759
OrthoInspector 1 1.000 T32155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
66.170

Return to query results.
Submit another query.