DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and TFL1

DIOPT Version :10

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_196004.1 Gene:TFL1 / 831683 AraportID:AT5G03840 Length:177 Species:Arabidopsis thaliana


Alignment Length:162 Identity:59/162 - (36%)
Similarity:85/162 - (52%) Gaps:12/162 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VIPDVI-HIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAP-ENYYALLMVDPDVPNA 93
            |:.||: ...|...:||:|:....:: |..|.|..|..:|.|:..... .:::.|:|:|||||..
plant    17 VVGDVLDFFTPTTKMNVSYNKKQVSN-GHELFPSSVSSKPRVEIHGGDLRSFFTLVMIDPDVPGP 80

  Fly    94 ITPTHREFLHWMVLNIPGNLLA-LGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPK 157
            ..|..:|.|||:|.||||...| .|...|.|  ..|....|.|||||:|::|:. .:..||.:| 
plant    81 SDPFLKEHLHWIVTNIPGTTDATFGKEVVSY--ELPRPSIGIHRFVFVLFRQKQ-RRVIFPNIP- 141

  Fly   158 HSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQ 189
                .|..|.|::||.:|..|.|||..||.:|
plant   142 ----SRDHFNTRKFAVEYDLGLPVAAVFFNAQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 54/145 (37%)
TFL1NP_196004.1 PEBP 4..177 CDD:469671 59/162 (36%)

Return to query results.
Submit another query.