DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and TSF

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_193770.1 Gene:TSF AraportID:AT4G20370 Length:175 Species:Arabidopsis thaliana

Alignment Length:153 Identity:59/154 (38%)
Similarity:80/154 (52%) Gaps:22/154 (14%)


  Fly    44 LNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAP-ENYYALLMVDPDVPNAITPTHREFLHWMVL 107
            |.||| ||.....|..|.|.||.::|.|:..... .|:|.|:|||||||:...|..||:|||:|.
plant    28 LKVTY-GHREVTNGLDLRPSQVLNKPIVEIGGDDFRNFYTLVMVDPDVPSPSNPHQREYLHWLVT 91

  Fly   108 NIP---GNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKG---RSGF 166
            :||   ||  |.|:..|.|  .:|...:|.||.|.:|::|          |.:.:|..   |..|
plant    92 DIPATTGN--AFGNEVVCY--ESPRPPSGIHRIVLVLFRQ----------LGRQTVYAPGWRQQF 142

  Fly   167 ETKRFAKKYRFGHPVAGNFFTSQ 189
            .|:.||:.|..|.|||.::|..|
plant   143 NTREFAEIYNLGLPVAASYFNCQ 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 58/151 (38%)
TSFNP_193770.1 PLN00169 1..175 CDD:177765 59/154 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
OMA 1 1.010
OrthoDB 1 1.010 D1557122at2759
OrthoInspector 1 1.000 T32155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 1 0.910 0.600 Consistency score
77.080

Return to query results.
Submit another query.