DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and Pbp2

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_083871.3 Gene:Pbp2 MGIID:1923650 Length:187 Species:Mus musculus

Alignment Length:165 Identity:66/166 (40%)
Similarity:93/166 (56%) Gaps:2/166 (1%)


  Fly    40 PQEFLNVTYHGHLAAHCGKVLEPMQVRDEP-SVKWPSAPE-NYYALLMVDPDVPNAITPTHREFL 102
            ||..|.|||........|:||.|.||:..| |:.|..... ..|.|::.|||.|:...|.:||:.
Mouse    21 PQHLLRVTYTEAEVEELGQVLTPTQVKHRPGSISWDGLDTGKLYTLILTDPDAPSRKKPVYREWH 85

  Fly   103 HWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFE 167
            |::|:|:.||.::.|:|...|:|:.|.||||.||:|:|:|:|....:.|.|.|...|...|..|:
Mouse    86 HFLVVNMKGNDISSGNVLSDYVGSGPPKGTGLHRYVWLVYQQDKPLRCDEPILTNRSGDHRGKFK 150

  Fly   168 TKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAIS 202
            |..|.|||..|.||||..:.::|...||.|.|.:|
Mouse   151 TAAFRKKYHLGAPVAGTCYQAEWDSYVPKLYKQLS 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 58/146 (40%)
Pbp2NP_083871.3 PEBP_euk 23..171 CDD:176644 58/148 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86923949
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.900

Return to query results.
Submit another query.