DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and Pebp4

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_082836.2 Gene:Pebp4 MGIID:1920773 Length:242 Species:Mus musculus

Alignment Length:162 Identity:45/163 (28%)
Similarity:73/163 (45%) Gaps:19/163 (12%)


  Fly    56 CGKVLEPMQVRDEPSVKWPSAPEN-YYALLMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDV 119
            |....:.:.....|.||:.:|.:. .|.|:|||||.|:...|..:.:.||:|.||.|..:..|.:
Mouse    86 CNLYRQKITAWQAPIVKFHTALDGALYLLVMVDPDAPSRSNPVMKYWRHWLVSNITGADMKSGSI 150

  Fly   120 R----VGYMGATPLKGTGTHRFVFLLYKQ--RDYTKFDFPKLPKHSVKGRS---GFETKRFAKKY 175
            |    ..|...||...||.||:.|.:|.|  ||.:.         ||:.::   |:...:|.::|
Mouse   151 RGNVLSDYSPPTPPPETGLHRYQFFVYLQGDRDISL---------SVEEKADLGGWNLDKFLQQY 206

  Fly   176 RFGHPVAGNFFTSQWSPDVPSLIKAISHNARQ 207
            ....|.....|.:|:..::.|....|:.:..|
Mouse   207 GLRDPDTSTQFMTQFDEELSSEFGRINDDQEQ 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 41/142 (29%)
Pebp4NP_082836.2 PEBP_euk 95..219 CDD:176644 40/133 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.