DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and Pebp4

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_008768114.2 Gene:Pebp4 RGDID:1593295 Length:272 Species:Rattus norvegicus

Alignment Length:147 Identity:42/148 (28%)
Similarity:68/148 (46%) Gaps:13/148 (9%)


  Fly    56 CGKVLEPMQVRDEPSVKWPSAPEN-YYALLMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDV 119
            |.:....:.....|.||:..|.:. .|.|:|||||.|:...|..:.:.||:|.||.|..:..|.:
  Rat   116 CNQYRRKIMTWQSPIVKFHGALDGAQYLLVMVDPDAPSRSNPRMKYWRHWVVSNITGTDMKSGSI 180

  Fly   120 R----VGYMGATPLKGTGTHRFVFLLYKQ--RDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFG 178
            |    ..|...||...||.||:.|.:|.|  ||.:      :|:...:.|..::..:|.::|...
  Rat   181 RGNIITDYQPPTPPPTTGLHRYQFFVYLQGDRDIS------IPESENENRGAWKLDKFLQQYGLQ 239

  Fly   179 HPVAGNFFTSQWSPDVP 195
            .|.....|.:|:..::|
  Rat   240 DPDTSTQFMTQFDGELP 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 40/139 (29%)
Pebp4XP_008768114.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.