DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and Pebp4

DIOPT Version :10

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_008769058.2 Gene:Pebp4 / 691997 RGDID:1593295 Length:235 Species:Rattus norvegicus


Alignment Length:147 Identity:42/147 - (28%)
Similarity:68/147 - (46%) Gaps:13/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CGKVLEPMQVRDEPSVKWPSAPEN-YYALLMVDPDVPNAITPTHREFLHWMVLNIPGNLLALGDV 119
            |.:....:.....|.||:..|.:. .|.|:|||||.|:...|..:.:.||:|.||.|..:..|.:
  Rat    79 CNQYRRKIMTWQSPIVKFHGALDGAQYLLVMVDPDAPSRSNPRMKYWRHWVVSNITGTDMKSGSI 143

  Fly   120 R----VGYMGATPLKGTGTHRFVFLLYKQ--RDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFG 178
            |    ..|...||...||.||:.|.:|.|  ||.:      :|:...:.|..::..:|.::|...
  Rat   144 RGNIITDYQPPTPPPTTGLHRYQFFVYLQGDRDIS------IPESENENRGAWKLDKFLQQYGLQ 202

  Fly   179 HPVAGNFFTSQWSPDVP 195
            .|.....|.:|:..::|
  Rat   203 DPDTSTQFMTQFDGELP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 40/138 (29%)
Pebp4XP_008769058.2 PEBP_euk 60..212 CDD:176644 40/138 (29%)

Return to query results.
Submit another query.