DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and Mrpl38

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_077139.2 Gene:Mrpl38 MGIID:1926269 Length:380 Species:Mus musculus

Alignment Length:164 Identity:48/165 (29%)
Similarity:79/165 (48%) Gaps:22/165 (13%)


  Fly    38 IGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALLMVDPD----VPNAITPTH 98
            :|.::.:.| |||:       .:.|.:....|.|.:.:..::.:.||.::.|    .|:|     
Mouse   179 VGEEDLIPV-YHGN-------EVTPTEASRAPEVTYEADKDSLWTLLFINLDGHLLEPDA----- 230

  Fly    99 REFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKF--DFPKLPKHSVK 161
             |::||::.|||.|.:|.|.....|:...|.:|:|.|||.|||:||.....|  |....|.:.:.
Mouse   231 -EYVHWLLTNIPSNRVAEGQETCPYLPPFPARGSGFHRFAFLLFKQDKPINFSEDTRPSPCYQLA 294

  Fly   162 GRSGFETKRFAKKYRFGHPVAG-NFFTSQWSPDV 194
            .|: |.|..|.|:::.....|| .||..:|...|
Mouse   295 QRT-FRTFDFYKRHQEAMTPAGLAFFQCRWDDSV 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 45/151 (30%)
Mrpl38NP_077139.2 PEBP_euk 171..321 CDD:176644 46/157 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.