DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and mrpl38

DIOPT Version :10

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_012814540.2 Gene:mrpl38 / 549900 XenbaseID:XB-GENE-5959674 Length:406 Species:Xenopus tropicalis


Alignment Length:156 Identity:55/156 - (35%)
Similarity:77/156 - (49%) Gaps:13/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALLMVDPDVPNAITPTHREFLHWMV 106
            |||...|||:|       :.|.:....|.|.:.:...:.:.||:.:||  ..:..|..|::.|:|
 Frog   208 EFLMPVYHGNL-------VTPAEASGPPEVTFEAEEGSLWTLLLTNPD--GHLKETDSEYVLWLV 263

  Fly   107 LNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQ--RDYTKFDFPKLPKHSVKGRSGFETK 169
            .|||||.:..|:....|....|.||||.||.:|||:||  |...|.:....|.||:|.|: |:|.
 Frog   264 GNIPGNQVHSGEQICHYFPPFPAKGTGYHRHIFLLFKQDRRIEFKDELRPNPCHSLKLRT-FKTL 327

  Fly   170 RFAKKYRFGHPVAG-NFFTSQWSPDV 194
            .|.:||......|| .||...|...|
 Frog   328 DFYRKYEESLTPAGLAFFQCAWDDSV 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 51/146 (35%)
mrpl38XP_012814540.2 PEBP_euk 197..347 CDD:176644 53/148 (36%)

Return to query results.
Submit another query.