DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and pebp1

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001016825.1 Gene:pebp1 XenbaseID:XB-GENE-973798 Length:186 Species:Xenopus tropicalis

Alignment Length:165 Identity:62/166 (37%)
Similarity:93/166 (56%) Gaps:2/166 (1%)


  Fly    40 PQEFLNVTYHGHLAAHCGKVLEPMQVRDEP-SVKWPSAPEN-YYALLMVDPDVPNAITPTHREFL 102
            |.:.|.|||........|:||.|.||:..| |::|.....: .|.|::.|||.|:...|..||:.
 Frog    21 PAQPLLVTYGSLGIDELGQVLTPTQVQSRPSSIEWEGMDSSKLYTLVLTDPDAPSRKNPKFREWH 85

  Fly   103 HWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFE 167
            |::|:|:.||.:..|.|...|:|:.|.||||.||:|:|:|:|.:..|.....|...|.:.|..|:
 Frog    86 HFLVVNMKGNNINSGCVLSDYVGSGPPKGTGLHRYVWLVYEQTEELKCTERVLCNRSGEHRGMFK 150

  Fly   168 TKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAIS 202
            ...|.:||:.|.|||||.:.::|...||.|.:.:|
 Frog   151 VASFRQKYKLGTPVAGNCYQAEWDDYVPKLYEQLS 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 56/146 (38%)
pebp1NP_001016825.1 PEBP_euk 24..171 CDD:176644 56/147 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86923707
eggNOG 1 0.900 E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.