DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and Pebp1

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_651051.1 Gene:Pebp1 FlyBaseID:FBgn0038973 Length:176 Species:Drosophila melanogaster

Alignment Length:179 Identity:74/180 (41%)
Similarity:108/180 (60%) Gaps:7/180 (4%)


  Fly    26 MRSLDVIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALLMVDPDV 90
            |.:..:|||:|.:.|.....:||...:....||.|.|.||:|:|:|.:.:.|.:.|.:|:||||.
  Fly     1 MDTAGIIPDIIDVKPASKATITYPSGVQVELGKELTPTQVKDQPTVVFDAEPNSLYTILLVDPDA 65

  Fly    91 PNAITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRD---YTKFDF 152
            |:...|..||.|||:|:|||||.::.|.....|:||.|.:|||.||:|||::||.|   ..||  
  Fly    66 PSREDPKFRELLHWLVINIPGNKVSEGQTIAEYIGAGPREGTGLHRYVFLVFKQNDKITTEKF-- 128

  Fly   153 PKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAI 201
              :.|.|..||...:.:.:.:||.||.|||||||.:|:...|.:||:.:
  Fly   129 --VSKTSRTGRINVKARDYIQKYSFGGPVAGNFFQAQYDDYVKTLIETV 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 64/147 (44%)
Pebp1NP_651051.1 PEBP_euk 20..162 CDD:176644 64/146 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4806062
eggNOG 1 0.900 E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11362
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.