DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and CG7054

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_651050.1 Gene:CG7054 FlyBaseID:FBgn0038972 Length:179 Species:Drosophila melanogaster

Alignment Length:180 Identity:68/181 (38%)
Similarity:95/181 (52%) Gaps:13/181 (7%)


  Fly    30 DVIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWP--SAPENYYALLMVDPDVPN 92
            |::|||:...|...:.|.|...|....|..|.|.||:|:|.|.|.  ....|...|||||||.|.
  Fly     3 DIVPDVLDAVPAGTIKVIYGDDLEVKQGNELTPTQVKDQPIVSWSGLEGKSNLLTLLMVDPDAPT 67

  Fly    93 AITPTHREFLHWMVLNIPGNL------LALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFD 151
            ...|.:||.|||.|:||||:.      .:|.|    |:|:.|.|.||.||::||||:|.:..: :
  Fly    68 RQDPKYREILHWSVVNIPGSNENPSGGHSLAD----YVGSGPPKDTGLHRYIFLLYRQENKIE-E 127

  Fly   152 FPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAI 201
            .|.:...:..||..|..:.||.|:..|.|:|.|::.:|:...||...|.|
  Fly   128 TPTISNTTRTGRLNFNARDFAAKHGLGEPIAANYYQAQYDDYVPIRNKTI 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 58/152 (38%)
CG7054NP_651050.1 PEBP_euk 15..164 CDD:176644 58/154 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4806057
eggNOG 1 0.900 E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11362
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.