DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and CG17919

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_649644.1 Gene:CG17919 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster

Alignment Length:183 Identity:81/184 (44%)
Similarity:111/184 (60%) Gaps:0/184 (0%)


  Fly    22 VSKIMRSLDVIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALLMV 86
            |.::.||..|:||||...|.:.|.|||..:|.|..|..|.|.||:|:|.|:|.:.|..:|.|:|.
  Fly    20 VEEVFRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQPGEFYTLIMT 84

  Fly    87 DPDVPNAITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFD 151
            |||.|:...|..|||.||::.||.||.||.|:....|:|:.|.:|||.||:|||||||....:||
  Fly    85 DPDAPSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFD 149

  Fly   152 FPKLPKHSVKGRSGFETKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAISHN 204
            ..::.|.|.|.|..|...:||..:..|:|:||.|:.:|:...||.|.|.:|.|
  Fly   150 EERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQLSEN 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 65/144 (45%)
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 65/145 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86935811
eggNOG 1 0.900 E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11362
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.