DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17917 and CG10298

Sequence 1:NP_649642.1 Gene:CG17917 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_649643.1 Gene:CG10298 FlyBaseID:FBgn0037432 Length:187 Species:Drosophila melanogaster

Alignment Length:172 Identity:77/173 (45%)
Similarity:104/173 (60%) Gaps:0/173 (0%)


  Fly    31 VIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALLMVDPDVPNAIT 95
            ::||::...|...|.|||.|......|..|.|.||:.:|.|||.:.|..:|.||:.|||.|:...
  Fly    13 IVPDILKTCPATLLTVTYGGGQVVDVGGELTPTQVQSQPKVKWDADPNAFYTLLLTDPDAPSRKE 77

  Fly    96 PTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSV 160
            |..||:.||:|:|||||.:..|.|...|:||.|.:|||.||:|||::||......:.||:||.|.
  Fly    78 PKFREWHHWLVVNIPGNQVENGVVLTEYVGAGPPQGTGLHRYVFLVFKQPQKLTCNEPKIPKTSG 142

  Fly   161 KGRSGFETKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAIS 202
            ..|:.|.|.:|..||:.|.|:|||||.:||...||.|.|.:|
  Fly   143 DKRANFSTSKFMSKYKLGDPIAGNFFQAQWDDYVPKLYKQLS 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 67/144 (47%)
CG10298NP_649643.1 PEBP_euk 24..170 CDD:176644 67/146 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86935826
eggNOG 1 0.900 E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2071
Isobase 1 0.950 0 Normalized mean entropy S1728
OrthoDB 1 1.010 D1557122at2759
OrthoFinder 1 1.000 FOG0000385
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11362
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.