powered by:
Protein Alignment CG17917 and CG10298
DIOPT Version :9
| Sequence 1: | NP_649642.1 |
Gene: | CG17917 / 40778 |
FlyBaseID: | FBgn0037431 |
Length: | 211 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_649643.1 |
Gene: | CG10298 / 40779 |
FlyBaseID: | FBgn0037432 |
Length: | 187 |
Species: | Drosophila melanogaster |
| Alignment Length: | 172 |
Identity: | 77/172 - (44%) |
| Similarity: | 104/172 - (60%) |
Gaps: | 0/172 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 31 VIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALLMVDPDVPNAIT 95
::||::...|...|.|||.|......|..|.|.||:.:|.|||.:.|..:|.||:.|||.|:...
Fly 13 IVPDILKTCPATLLTVTYGGGQVVDVGGELTPTQVQSQPKVKWDADPNAFYTLLLTDPDAPSRKE 77
Fly 96 PTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSV 160
|..||:.||:|:|||||.:..|.|...|:||.|.:|||.||:|||::||......:.||:||.|.
Fly 78 PKFREWHHWLVVNIPGNQVENGVVLTEYVGAGPPQGTGLHRYVFLVFKQPQKLTCNEPKIPKTSG 142
Fly 161 KGRSGFETKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAIS 202
..|:.|.|.:|..||:.|.|:|||||.:||...||.|.|.:|
Fly 143 DKRANFSTSKFMSKYKLGDPIAGNFFQAQWDDYVPKLYKQLS 184
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C45452396 |
| Domainoid |
1 |
1.000 |
87 |
1.000 |
Domainoid score |
I2734 |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1881 |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
1 |
1.050 |
104 |
1.000 |
Inparanoid score |
I2131 |
| Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S1728 |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D117065at6960 |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000438 |
| OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm963 |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR11362 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X275 |
|
11 | 10.850 |
|
Return to query results.
Submit another query.