DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17917 and CG10298

DIOPT Version :9

Sequence 1:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_649643.1 Gene:CG10298 / 40779 FlyBaseID:FBgn0037432 Length:187 Species:Drosophila melanogaster


Alignment Length:172 Identity:77/172 - (44%)
Similarity:104/172 - (60%) Gaps:0/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VIPDVIHIGPQEFLNVTYHGHLAAHCGKVLEPMQVRDEPSVKWPSAPENYYALLMVDPDVPNAIT 95
            ::||::...|...|.|||.|......|..|.|.||:.:|.|||.:.|..:|.||:.|||.|:...
  Fly    13 IVPDILKTCPATLLTVTYGGGQVVDVGGELTPTQVQSQPKVKWDADPNAFYTLLLTDPDAPSRKE 77

  Fly    96 PTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQRDYTKFDFPKLPKHSV 160
            |..||:.||:|:|||||.:..|.|...|:||.|.:|||.||:|||::||......:.||:||.|.
  Fly    78 PKFREWHHWLVVNIPGNQVENGVVLTEYVGAGPPQGTGLHRYVFLVFKQPQKLTCNEPKIPKTSG 142

  Fly   161 KGRSGFETKRFAKKYRFGHPVAGNFFTSQWSPDVPSLIKAIS 202
            ..|:.|.|.:|..||:.|.|:|||||.:||...||.|.|.:|
  Fly   143 DKRANFSTSKFMSKYKLGDPIAGNFFQAQWDDYVPKLYKQLS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 67/143 (47%)
CG10298NP_649643.1 PEBP_euk 24..170 CDD:176644 67/145 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452396
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
Isobase 1 0.950 - 0 Normalized mean entropy S1728
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
1110.850

Return to query results.
Submit another query.